Anti-RHOT2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RHOT2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA012895
• Supplier Catalog Number: HPA012895
• Alternative Catalog Number: ATA-HPA012895-100,ATA-HPA012895-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ARHT2, C16orf39, MIRO-2

Product Description

ras homolog family member T2

Additional Information

Anti-RHOT2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 89941
• UniProt: Q8IXI1
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RHOT2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.

Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human testis shows cytoplasmic positivity.

Immunohistochemical staining of human kidney shows cytoplasmic positivity in cells in tubules.

HPA012895

HPA012895

HPA012895