Anti-ATP1B1
Artikelnummer:
ATA-HPA012911
- Bilder (8)
| Artikelname: | Anti-ATP1B1 |
| Artikelnummer: | ATA-HPA012911 |
| Hersteller Artikelnummer: | HPA012911 |
| Alternativnummer: | ATA-HPA012911-100,ATA-HPA012911-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ATP1B |
| ATPase, Na+/K+ transporting, beta 1 polypeptide |
| Anti-ATP1B1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 481 |
| UniProt: | P05026 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ATP1B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
HPA012911-100ul |
|
|
|
|
|
HPA012911-100ul |
|
|
HPA012911-100ul |
Produktgarantie und fachkundiger Support
