Anti-ATP1B1
Catalog Number:
ATA-HPA012911
- Images (8)
| Article Name: | Anti-ATP1B1 |
| Biozol Catalog Number: | ATA-HPA012911 |
| Supplier Catalog Number: | HPA012911 |
| Alternative Catalog Number: | ATA-HPA012911-100,ATA-HPA012911-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | ATP1B |
| ATPase, Na+/K+ transporting, beta 1 polypeptide |
| Anti-ATP1B1 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 481 |
| UniProt: | P05026 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ATP1B1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-ATP1B1 antibody. Corresponding ATP1B1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
HPA012911-100ul |
|
|
|
|
|
HPA012911-100ul |
|
|
HPA012911-100ul |
Product Guarantee and Expert Support
