Anti-PARD6B Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013376
Artikelname: Anti-PARD6B Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013376
Hersteller Artikelnummer: HPA013376
Alternativnummer: ATA-HPA013376-100,ATA-HPA013376-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PAR-6B
par-6 family cell polarity regulator beta
Anti-PARD6B
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 84612
UniProt: Q9BYG5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PARD6B
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.
Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells.
HPA013376
HPA013376
HPA013376