Anti-PARD6B Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PARD6B Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013376
• Supplier Catalog Number: HPA013376
• Alternative Catalog Number: ATA-HPA013376-100,ATA-HPA013376-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PAR-6B

Product Description

par-6 family cell polarity regulator beta

Additional Information

Anti-PARD6B

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 84612
• UniProt: Q9BYG5
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PARD6B
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in macrophages.

Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.

Immunohistochemical staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells.

HPA013376

HPA013376

HPA013376