Anti-PDCD1LG2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013411
Artikelname: Anti-PDCD1LG2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013411
Hersteller Artikelnummer: HPA013411
Alternativnummer: ATA-HPA013411-100,ATA-HPA013411-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2
programmed cell death 1 ligand 2
Anti-PDCD1LG2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 80380
UniProt: Q9BQ51
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PDCD1LG2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemical staining of human tonsil shows moderate membranous positivity.
Immunohistochemical staining of human lung shows moderate cytoplasmic positivity.
Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
HPA013411
HPA013411
HPA013411