Anti-PDCD1LG2 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-PDCD1LG2 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013411
• Supplier Catalog Number: HPA013411
• Alternative Catalog Number: ATA-HPA013411-100,ATA-HPA013411-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: B7-DC, bA574F11.2, Btdc, CD273, PD-L2, PDL2

Product Description

programmed cell death 1 ligand 2

Additional Information

Anti-PDCD1LG2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 80380
• UniProt: Q9BQ51
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PDCD1LG2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemical staining of human tonsil shows moderate membranous positivity.

Immunohistochemical staining of human lung shows moderate cytoplasmic positivity.

Immunohistochemical staining of human stomach shows moderate membranous positivity in glandular cells.

Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

HPA013411

HPA013411

HPA013411