Anti-TBC1D32 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013413
Artikelname: Anti-TBC1D32 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013413
Hersteller Artikelnummer: HPA013413
Alternativnummer: ATA-HPA013413-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bA57L9.1, BROMI, C6orf170, C6orf171, dJ310J6.1, FLJ30899, FLJ34235
TBC1 domain family, member 32
Anti-TBC1D32
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 221322
UniProt: Q96NH3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TBC1D32
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line HDLM-2.
Western blot analysis in human cell line HEK 293.
HPA013413
HPA013413
HPA013413