Anti-TBC1D32 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TBC1D32 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013413
• Supplier Catalog Number: HPA013413
• Alternative Catalog Number: ATA-HPA013413-100
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: bA57L9.1, BROMI, C6orf170, C6orf171, dJ310J6.1, FLJ30899, FLJ34235

Product Description

TBC1 domain family, member 32

Additional Information

Anti-TBC1D32

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 221322
• UniProt: Q96NH3
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: TBC1D32
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.

Western blot analysis in human cell line HDLM-2.

Western blot analysis in human cell line HEK 293.

HPA013413

HPA013413

HPA013413