Anti-SLCO2A1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013742
Artikelname: Anti-SLCO2A1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013742
Hersteller Artikelnummer: HPA013742
Alternativnummer: ATA-HPA013742-100,ATA-HPA013742-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MATR1, OATP2A1, PGT, SLC21A2
solute carrier organic anion transporter family, member 2A1
Anti-SLCO2A1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6578
UniProt: Q92959
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLCO2A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human seminal vesicle and skeletal muscle tissues using HPA013742 antibody. Corresponding SLCO2A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.
Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.
Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.
Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
HPA013742
HPA013742
HPA013742