Anti-SLCO2A1 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-SLCO2A1 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013742
• Supplier Catalog Number: HPA013742
• Alternative Catalog Number: ATA-HPA013742-100,ATA-HPA013742-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MATR1, OATP2A1, PGT, SLC21A2

Product Description

solute carrier organic anion transporter family, member 2A1

Additional Information

Anti-SLCO2A1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 6578
• UniProt: Q92959
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: SLCO2A1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human seminal vesicle and skeletal muscle tissues using HPA013742 antibody. Corresponding SLCO2A1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.

Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.

Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.

Immunohistochemical staining of human skeletal muscle shows no positivity as expected.

HPA013742

HPA013742

HPA013742