Anti-RBM7 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013993
Artikelname: Anti-RBM7 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013993
Hersteller Artikelnummer: HPA013993
Alternativnummer: ATA-HPA013993-100,ATA-HPA013993-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RBM7
RNA binding motif protein 7
Anti-RBM7
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 10179
UniProt: Q9Y580
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBM7
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
HPA013993
HPA013993
HPA013993