Anti-RBM7 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-RBM7 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA013993
• Supplier Catalog Number: HPA013993
• Alternative Catalog Number: ATA-HPA013993-100,ATA-HPA013993-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: RBM7

Product Description

RNA binding motif protein 7

Additional Information

Anti-RBM7

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 10179
• UniProt: Q9Y580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: HEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQW
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: RBM7
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.

Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular cells.

Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.

Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.

Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.

HPA013993

HPA013993

HPA013993