Anti-IQGAP1

Artikelnummer: ATA-HPA014055
Artikelname: Anti-IQGAP1
Artikelnummer: ATA-HPA014055
Hersteller Artikelnummer: HPA014055
Alternativnummer: ATA-HPA014055-100,ATA-HPA014055-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HUMORFA01, KIAA0051, p195, SAR1
IQ motif containing GTPase activating protein 1
Anti-IQGAP1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 8826
UniProt: P46940
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IQGAP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using Anti-IQGAP1 antibody. Corresponding IQGAP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line A-431.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA014055-100ul
HPA014055-100ul
HPA014055-100ul