Anti-IQGAP1 Antibody , Unconjugated, Rabbit, Polyclonal

Catalog Number: ATA-HPA014055
Article Name: Anti-IQGAP1 Antibody , Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA014055
Supplier Catalog Number: HPA014055
Alternative Catalog Number: ATA-HPA014055-100,ATA-HPA014055-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: HUMORFA01, KIAA0051, p195, SAR1
IQ motif containing GTPase activating protein 1
Anti-IQGAP1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 8826
UniProt: P46940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: IQGAP1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using Anti-IQGAP1 antibody. Corresponding IQGAP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human endometrium shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line A-431.
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA014055
HPA014055
HPA014055