Anti-FAM210A Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014324
Artikelname: Anti-FAM210A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014324
Hersteller Artikelnummer: HPA014324
Alternativnummer: ATA-HPA014324-100,ATA-HPA014324-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C18orf19, HsT2329, MGC24180
family with sequence similarity 210, member A
Anti-FAM210A
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 125228
UniProt: Q96ND0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAM210A
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in glial cells.
Western blot analysis in human cell lines U2OS and HeLa using Anti-FAM210A antibody. Corresponding FAM210A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM210A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407602).
HPA014324
HPA014324
HPA014324