Anti-FAM210A Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-FAM210A Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA014324
• Supplier Catalog Number: HPA014324
• Alternative Catalog Number: ATA-HPA014324-100,ATA-HPA014324-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C18orf19, HsT2329, MGC24180

Product Description

family with sequence similarity 210, member A

Additional Information

Anti-FAM210A

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 125228
• UniProt: Q96ND0
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKE
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: FAM210A
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.

Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in glial cells.

Western blot analysis in human cell lines U2OS and HeLa using Anti-FAM210A antibody. Corresponding FAM210A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Western blot analysis in control (vector only transfected HEK293T lysate) and FAM210A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407602).

HPA014324

HPA014324

HPA014324