Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA014432
| Artikelname: |
Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA014432 |
| Hersteller Artikelnummer: |
HPA014432 |
| Alternativnummer: |
ATA-HPA014432-100,ATA-HPA014432-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DFNB74, DKFZp686C1178, FLJ36866 |
| methionine sulfoxide reductase B3 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.1 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
253827 |
| UniProt: |
Q8IXL7 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
MSRB3 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells. |
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli. |
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
Western blot analysis in human cell line A-549. |
|
HPA014432 |
|
|
|
HPA014432 |
|
HPA014432 |