Anti-MSRB3
Artikelnummer:
ATA-HPA014432
- Bilder (9)
| Artikelname: | Anti-MSRB3 |
| Artikelnummer: | ATA-HPA014432 |
| Hersteller Artikelnummer: | HPA014432 |
| Alternativnummer: | ATA-HPA014432-100,ATA-HPA014432-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DFNB74, DKFZp686C1178, FLJ36866 |
| methionine sulfoxide reductase B3 |
| Anti-MSRB3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 253827 |
| UniProt: | Q8IXL7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MSRB3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in human cell line A-549. |
|
|
HPA014432-100ul |
|
|
|
|
|
HPA014432-100ul |
|
|
HPA014432-100ul |
Produktgarantie und fachkundiger Support
