Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014432
Artikelname: Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014432
Hersteller Artikelnummer: HPA014432
Alternativnummer: ATA-HPA014432-100,ATA-HPA014432-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DFNB74, DKFZp686C1178, FLJ36866
methionine sulfoxide reductase B3
Anti-MSRB3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 253827
UniProt: Q8IXL7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MSRB3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Western blot analysis in human cell line A-549.
HPA014432
HPA014432
HPA014432