Anti-MSRB3
Catalog Number:
ATA-HPA014432
- Images (9)
| Article Name: | Anti-MSRB3 |
| Biozol Catalog Number: | ATA-HPA014432 |
| Supplier Catalog Number: | HPA014432 |
| Alternative Catalog Number: | ATA-HPA014432-100,ATA-HPA014432-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DFNB74, DKFZp686C1178, FLJ36866 |
| methionine sulfoxide reductase B3 |
| Anti-MSRB3 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 253827 |
| UniProt: | Q8IXL7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MSRB3 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Western blot analysis in human cell line A-549. |
|
|
HPA014432-100ul |
|
|
|
|
|
HPA014432-100ul |
|
|
HPA014432-100ul |
Product Guarantee and Expert Support
