Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-MSRB3 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA014432
• Supplier Catalog Number: HPA014432
• Alternative Catalog Number: ATA-HPA014432-100,ATA-HPA014432-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DFNB74, DKFZp686C1178, FLJ36866

Product Description

methionine sulfoxide reductase B3

Additional Information

Anti-MSRB3

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 253827
• UniProt: Q8IXL7
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: MSRB3
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml

Images

Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.

Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Western blot analysis in human cell line A-549.

HPA014432

HPA014432

HPA014432