Anti-MSRB3

Catalog Number: ATA-HPA014432
Article Name: Anti-MSRB3
Biozol Catalog Number: ATA-HPA014432
Supplier Catalog Number: HPA014432
Alternative Catalog Number: ATA-HPA014432-100,ATA-HPA014432-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DFNB74, DKFZp686C1178, FLJ36866
methionine sulfoxide reductase B3
Anti-MSRB3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 253827
UniProt: Q8IXL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYC
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: MSRB3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Western blot analysis in human cell line A-549.
HPA014432-100ul
HPA014432-100ul
HPA014432-100ul