Anti-P2RY12
Artikelnummer:
ATA-HPA014518
- Bilder (8)
| Artikelname: | Anti-P2RY12 |
| Artikelnummer: | ATA-HPA014518 |
| Hersteller Artikelnummer: | HPA014518 |
| Alternativnummer: | ATA-HPA014518-100,ATA-HPA014518-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HORK3, P2Y12, SP1999 |
| purinergic receptor P2Y, G-protein coupled, 12 |
| Anti-P2RY12 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 64805 |
| UniProt: | Q9H244 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | P2RY12 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA014518 antibody. Corresponding P2RY12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in microglia. |
|
|
Immunohistochemical staining of human liver shows no positivity as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia. |
|
|
HPA014518-100ul |
|
|
HPA014518-100ul |
|
|
HPA014518-100ul |
Produktgarantie und fachkundiger Support
