Anti-P2RY12
Catalog Number:
ATA-HPA014518
- Images (8)
| Article Name: | Anti-P2RY12 |
| Biozol Catalog Number: | ATA-HPA014518 |
| Supplier Catalog Number: | HPA014518 |
| Alternative Catalog Number: | ATA-HPA014518-100,ATA-HPA014518-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | HORK3, P2Y12, SP1999 |
| purinergic receptor P2Y, G-protein coupled, 12 |
| Anti-P2RY12 |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 64805 |
| UniProt: | Q9H244 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | P2RY12 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA014518 antibody. Corresponding P2RY12 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in microglia. |
|
|
Immunohistochemical staining of human liver shows no positivity as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia. |
|
|
HPA014518-100ul |
|
|
HPA014518-100ul |
|
|
HPA014518-100ul |
Product Guarantee and Expert Support
