Anti-GNPTAB, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014558
Artikelname: Anti-GNPTAB, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014558
Hersteller Artikelnummer: HPA014558
Alternativnummer: ATA-HPA014558-100,ATA-HPA014558-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GNPTA, KIAA1208, MGC4170
N-acetylglucosamine-1-phosphate transferase alpha and beta subunits
Anti-GNPTAB
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 79158
UniProt: Q3T906
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QELNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.