Anti-GNPTAB, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-GNPTAB, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA014558
• Supplier Catalog Number: HPA014558
• Alternative Catalog Number: ATA-HPA014558-100,ATA-HPA014558-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: GNPTA, KIAA1208, MGC4170

Product Description

N-acetylglucosamine-1-phosphate transferase alpha and beta subunits

Additional Information

Anti-GNPTAB

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 79158
• UniProt: Q3T906
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: QELNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVW
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml

Images

Immunofluorescent staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.