Anti-GJA8
Artikelnummer:
ATA-HPA014715
- Bilder (8)
| Artikelname: | Anti-GJA8 |
| Artikelnummer: | ATA-HPA014715 |
| Hersteller Artikelnummer: | HPA014715 |
| Alternativnummer: | ATA-HPA014715-100,ATA-HPA014715-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CAE, CAE1, CX50, CZP1 |
| gap junction protein alpha 8 |
| Anti-GJA8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2703 |
| UniProt: | P48165 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GJA8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, eye, kidney and testis using Anti-GJA8 antibody HPA014715 (A) shows similar protein distribution across tissues to independent antibody HPA062940 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human kidney using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human eye using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human testis using Anti-GJA8 antibody HPA014715. |
|
|
HPA014715-100ul |
|
|
HPA014715-100ul |
|
|
HPA014715-100ul |
Produktgarantie und fachkundiger Support
