Anti-GJA8
Catalog Number:
ATA-HPA014715
- Images (8)
| Article Name: | Anti-GJA8 |
| Biozol Catalog Number: | ATA-HPA014715 |
| Supplier Catalog Number: | HPA014715 |
| Alternative Catalog Number: | ATA-HPA014715-100,ATA-HPA014715-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CAE, CAE1, CX50, CZP1 |
| gap junction protein alpha 8 |
| Anti-GJA8 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2703 |
| UniProt: | P48165 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | GJA8 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human cerebral cortex, eye, kidney and testis using Anti-GJA8 antibody HPA014715 (A) shows similar protein distribution across tissues to independent antibody HPA062940 (B). |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human kidney using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human eye using Anti-GJA8 antibody HPA014715. |
|
|
Immunohistochemical staining of human testis using Anti-GJA8 antibody HPA014715. |
|
|
HPA014715-100ul |
|
|
HPA014715-100ul |
|
|
HPA014715-100ul |
Product Guarantee and Expert Support
