Anti-YIF1A Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA014840
- Bilder (9)
| Artikelname: | Anti-YIF1A Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA014840 |
| Hersteller Artikelnummer: | HPA014840 |
| Alternativnummer: | ATA-HPA014840-100,ATA-HPA014840-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 54TM, FinGER7, YIF1, YIF1P |
| Yip1 interacting factor homolog A (S. cerevisiae) |
| Anti-YIF1A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10897 |
| UniProt: | O95070 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | YIF1A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA014840 |
|
|
HPA014840 |
|
|
HPA014840 |
Produktgarantie und fachkundiger Support
