Anti-YIF1A Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA014840
- Images (9)
| Article Name: | Anti-YIF1A Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA014840 |
| Supplier Catalog Number: | HPA014840 |
| Alternative Catalog Number: | ATA-HPA014840-100,ATA-HPA014840-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | 54TM, FinGER7, YIF1, YIF1P |
| Yip1 interacting factor homolog A (S. cerevisiae) |
| Anti-YIF1A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 10897 |
| UniProt: | O95070 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | YIF1A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA014840 |
|
|
HPA014840 |
|
|
HPA014840 |
Product Guarantee and Expert Support
