Anti-PON3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA014848
- Bilder (9)
| Artikelname: | Anti-PON3 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA014848 |
| Hersteller Artikelnummer: | HPA014848 |
| Alternativnummer: | ATA-HPA014848-100,ATA-HPA014848-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PON3 |
| paraoxonase 3 |
| Anti-PON3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5446 |
| UniProt: | Q15166 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | REVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PON3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human liver and kidney tissues using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
Western blot analysis in human cell lines A-549 and HEK293 using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA014848 |
|
|
|
|
|
HPA014848 |
|
|
HPA014848 |
Produktgarantie und fachkundiger Support
