Anti-PON3

Artikelnummer: ATA-HPA014848
Artikelname: Anti-PON3
Artikelnummer: ATA-HPA014848
Hersteller Artikelnummer: HPA014848
Alternativnummer: ATA-HPA014848-100,ATA-HPA014848-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PON3
paraoxonase 3
Anti-PON3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5446
UniProt: Q15166
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: REVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PON3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human liver and kidney tissues using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Western blot analysis in human cell lines A-549 and HEK293 using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA014848-100ul
HPA014848-100ul
HPA014848-100ul