Anti-PON3

Catalog Number: ATA-HPA014848
Article Name: Anti-PON3
Biozol Catalog Number: ATA-HPA014848
Supplier Catalog Number: HPA014848
Alternative Catalog Number: ATA-HPA014848-100,ATA-HPA014848-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PON3
paraoxonase 3
Anti-PON3
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 5446
UniProt: Q15166
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: REVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLKYPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PON3
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human liver and kidney tissues using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human liver shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
Western blot analysis in human cell lines A-549 and HEK293 using Anti-PON3 antibody. Corresponding PON3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA014848-100ul
HPA014848-100ul
HPA014848-100ul