Anti-ST6GALNAC1

Artikelnummer: ATA-HPA014975
Artikelname: Anti-ST6GALNAC1
Artikelnummer: ATA-HPA014975
Hersteller Artikelnummer: HPA014975
Alternativnummer: ATA-HPA014975-100,ATA-HPA014975-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SIAT7A, ST6GalNAcI
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Anti-ST6GALNAC1
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 55808
UniProt: Q9NSC7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ST6GALNAC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human rectum and pancreas tissues using HPA014975 antibody. Corresponding ST6GALNAC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemical staining of human endometrium shows strong positivity in Golgi apparatus in glandular cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human rectum shows strong positivity in Golgi apparatus in glandular cells.
HPA014975-100ul
HPA014975-100ul
HPA014975-100ul