Anti-ST6GALNAC1
Catalog Number:
ATA-HPA014975
- Images (8)
| Article Name: | Anti-ST6GALNAC1 |
| Biozol Catalog Number: | ATA-HPA014975 |
| Supplier Catalog Number: | HPA014975 |
| Alternative Catalog Number: | ATA-HPA014975-100,ATA-HPA014975-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | SIAT7A, ST6GalNAcI |
| ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 |
| Anti-ST6GALNAC1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 55808 |
| UniProt: | Q9NSC7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGN |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | ST6GALNAC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human rectum and pancreas tissues using HPA014975 antibody. Corresponding ST6GALNAC1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human stomach shows strong positivity in Golgi apparatus in glandular cells. |
|
|
Immunohistochemical staining of human endometrium shows strong positivity in Golgi apparatus in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human rectum shows strong positivity in Golgi apparatus in glandular cells. |
|
|
HPA014975-100ul |
|
|
HPA014975-100ul |
|
|
HPA014975-100ul |
Product Guarantee and Expert Support
