Anti-BRD4

Artikelnummer: ATA-HPA015055
Artikelname: Anti-BRD4
Artikelnummer: ATA-HPA015055
Hersteller Artikelnummer: HPA015055
Alternativnummer: ATA-HPA015055-100,ATA-HPA015055-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CAP, HUNK1, HUNKI, MCAP
bromodomain containing 4
Anti-BRD4
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 23476
UniProt: O60885
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BRD4
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.
Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
HPA015055-100ul
HPA015055-100ul
HPA015055-100ul