Anti-BRD4

Catalog Number: ATA-HPA015055
Article Name: Anti-BRD4
Biozol Catalog Number: ATA-HPA015055
Supplier Catalog Number: HPA015055
Alternative Catalog Number: ATA-HPA015055-100,ATA-HPA015055-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAP, HUNK1, HUNKI, MCAP
bromodomain containing 4
Anti-BRD4
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 23476
UniProt: O60885
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: BRD4
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.
Immunohistochemical staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.
Immunohistochemical staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
HPA015055-100ul
HPA015055-100ul
HPA015055-100ul