Anti-STK10

Artikelnummer: ATA-HPA015083
Artikelname: Anti-STK10
Artikelnummer: ATA-HPA015083
Hersteller Artikelnummer: HPA015083
Alternativnummer: ATA-HPA015083-100,ATA-HPA015083-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: LOK, PRO2729
serine/threonine kinase 10
Anti-STK10
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 6793
UniProt: O94804
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: STK10
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and HeLa using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA015083-100ul
HPA015083-100ul
HPA015083-100ul