Anti-STK10 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA015083
- Images (9)
| Article Name: | Anti-STK10 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA015083 |
| Supplier Catalog Number: | HPA015083 |
| Alternative Catalog Number: | ATA-HPA015083-100 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LOK, PRO2729 |
| serine/threonine kinase 10 |
| Anti-STK10 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 6793 |
| UniProt: | O94804 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | STK10 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and HeLa using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
|
|
|
HPA015083 |
|
|
HPA015083 |
|
|
HPA015083 |
Product Guarantee and Expert Support
