Anti-STK10

Catalog Number: ATA-HPA015083
Article Name: Anti-STK10
Biozol Catalog Number: ATA-HPA015083
Supplier Catalog Number: HPA015083
Alternative Catalog Number: ATA-HPA015083-100,ATA-HPA015083-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: LOK, PRO2729
serine/threonine kinase 10
Anti-STK10
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 6793
UniProt: O94804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TLENHTQNSSEVSPPSLNADKPLEESPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGG
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: STK10
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell lines SK-MEL-30 and HeLa using Anti-STK10 antibody. Corresponding STK10 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
HPA015083-100ul
HPA015083-100ul
HPA015083-100ul