Anti-B4GALNT1

Artikelnummer: ATA-HPA015128
Artikelname: Anti-B4GALNT1
Artikelnummer: ATA-HPA015128
Hersteller Artikelnummer: HPA015128
Alternativnummer: ATA-HPA015128-100,ATA-HPA015128-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: beta1-4GalNAc-T, GALGT, SPG26
beta-1,4-N-acetyl-galactosaminyl transferase 1
Anti-B4GALNT1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 2583
UniProt: Q00973
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: B4GALNT1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-B4GALNT1 antibody. Corresponding B4GALNT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, colon, lymph node and pancreas using Anti-B4GALNT1 antibody HPA015128 (A) shows similar protein distribution across tissues to independent antibody HPA008968 (B).
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human colon using Anti-B4GALNT1 antibody HPA015128.
Immunohistochemical staining of human lymph node using Anti-B4GALNT1 antibody HPA015128.
HPA015128-100ul
HPA015128-100ul
HPA015128-100ul