Anti-B4GALNT1 Antibody , Unconjugated, Rabbit, Polyclonal
Catalog Number:
ATA-HPA015128
- Images (9)
| Article Name: | Anti-B4GALNT1 Antibody , Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: | ATA-HPA015128 |
| Supplier Catalog Number: | HPA015128 |
| Alternative Catalog Number: | ATA-HPA015128-100,ATA-HPA015128-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | beta1-4GalNAc-T, GALGT, SPG26 |
| beta-1,4-N-acetyl-galactosaminyl transferase 1 |
| Anti-B4GALNT1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 2583 |
| UniProt: | Q00973 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | B4GALNT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-B4GALNT1 antibody. Corresponding B4GALNT1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, lymph node and pancreas using Anti-B4GALNT1 antibody HPA015128 (A) shows similar protein distribution across tissues to independent antibody HPA008968 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human colon using Anti-B4GALNT1 antibody HPA015128. |
|
|
Immunohistochemical staining of human lymph node using Anti-B4GALNT1 antibody HPA015128. |
|
|
HPA015128 |
|
|
HPA015128 |
|
|
HPA015128 |
Product Guarantee and Expert Support
