Anti-B4GALNT1

Catalog Number: ATA-HPA015128
Article Name: Anti-B4GALNT1
Biozol Catalog Number: ATA-HPA015128
Supplier Catalog Number: HPA015128
Alternative Catalog Number: ATA-HPA015128-100,ATA-HPA015128-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: beta1-4GalNAc-T, GALGT, SPG26
beta-1,4-N-acetyl-galactosaminyl transferase 1
Anti-B4GALNT1
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 2583
UniProt: Q00973
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: B4GALNT1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-B4GALNT1 antibody. Corresponding B4GALNT1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, colon, lymph node and pancreas using Anti-B4GALNT1 antibody HPA015128 (A) shows similar protein distribution across tissues to independent antibody HPA008968 (B).
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human colon using Anti-B4GALNT1 antibody HPA015128.
Immunohistochemical staining of human lymph node using Anti-B4GALNT1 antibody HPA015128.
HPA015128-100ul
HPA015128-100ul
HPA015128-100ul