Anti-B4GALNT1

Product Overview

• Article Name: Anti-B4GALNT1
• Biozol Catalog Number: ATA-HPA015128
• Supplier Catalog Number: HPA015128
• Alternative Catalog Number: ATA-HPA015128-100,ATA-HPA015128-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Sonstiges
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: beta1-4GalNAc-T, GALGT, SPG26

Product Description

beta-1,4-N-acetyl-galactosaminyl transferase 1

Additional Information

Anti-B4GALNT1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.05 mg/ml
• Isotype: IgG
• NCBI: 2583
• UniProt: Q00973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: B4GALNT1
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-B4GALNT1 antibody. Corresponding B4GALNT1 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, colon, lymph node and pancreas using Anti-B4GALNT1 antibody HPA015128 (A) shows similar protein distribution across tissues to independent antibody HPA008968 (B).

Immunohistochemical staining of human cerebral cortex shows high expression.

Immunohistochemical staining of human pancreas shows low expression as expected.

Immunohistochemical staining of human colon using Anti-B4GALNT1 antibody HPA015128.

Immunohistochemical staining of human lymph node using Anti-B4GALNT1 antibody HPA015128.

HPA015128-100ul

HPA015128-100ul

HPA015128-100ul