Anti-CDK17

Artikelnummer: ATA-HPA015325
Artikelname: Anti-CDK17
Artikelnummer: ATA-HPA015325
Hersteller Artikelnummer: HPA015325
Alternativnummer: ATA-HPA015325-100,ATA-HPA015325-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PCTAIRE2, PCTK2
cyclin-dependent kinase 17
Anti-CDK17
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5128
UniProt: Q00537
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDK17
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
HPA015325-100ul
HPA015325-100ul
HPA015325-100ul