Anti-CDK17 Antibody , Unconjugated, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-CDK17 Antibody , Unconjugated, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA015325
• Supplier Catalog Number: HPA015325
• Alternative Catalog Number: ATA-HPA015325-100,ATA-HPA015325-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: PCTAIRE2, PCTK2

Product Description

cyclin-dependent kinase 17

Additional Information

Anti-CDK17

Product Properties

• Clonality: Polyclonal
• Concentration: 0.1 mg/ml
• Isotype: IgG
• NCBI: 5128
• UniProt: Q00537
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CDK17
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500

Images

Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.

Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.

HPA015325

HPA015325

HPA015325