Anti-ACBD3

Artikelnummer: ATA-HPA015594
Artikelname: Anti-ACBD3
Artikelnummer: ATA-HPA015594
Hersteller Artikelnummer: HPA015594
Alternativnummer: ATA-HPA015594-100,ATA-HPA015594-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GCP60, GOCAP1, GOLPH1, PAP7
acyl-CoA binding domain containing 3
Anti-ACBD3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 64746
UniProt: Q9H3P7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ACBD3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemical staining of human duodenum shows strong granular positivity in glandular cells.
Western blot analysis in human cell line U-2197.
Western blot analysis in control (vector only transfected HEK293T lysate) and ACBD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411600).
HPA015594-100ul
HPA015594-100ul
HPA015594-100ul