Anti-ACBD3

Catalog Number: ATA-HPA015594
Article Name: Anti-ACBD3
Biozol Catalog Number: ATA-HPA015594
Supplier Catalog Number: HPA015594
Alternative Catalog Number: ATA-HPA015594-100,ATA-HPA015594-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GCP60, GOCAP1, GOLPH1, PAP7
acyl-CoA binding domain containing 3
Anti-ACBD3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 64746
UniProt: Q9H3P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: ACBD3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemical staining of human duodenum shows strong granular positivity in glandular cells.
Western blot analysis in human cell line U-2197.
Western blot analysis in control (vector only transfected HEK293T lysate) and ACBD3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411600).
HPA015594-100ul
HPA015594-100ul
HPA015594-100ul