Anti-PLCE1
Artikelnummer:
ATA-HPA015597
- Bilder (7)
| Artikelname: | Anti-PLCE1 |
| Artikelnummer: | ATA-HPA015597 |
| Hersteller Artikelnummer: | HPA015597 |
| Alternativnummer: | ATA-HPA015597-100,ATA-HPA015597-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA1516, NPHS3, PLCE |
| phospholipase C, epsilon 1 |
| Anti-PLCE1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51196 |
| UniProt: | Q9P212 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PLCE1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human colon using Anti-PLCE1 antibody HPA015597. |
|
|
Immunohistochemical staining of human liver using Anti-PLCE1 antibody HPA015597. |
|
|
Immunohistochemical staining of human lymph node using Anti-PLCE1 antibody HPA015597. |
|
|
Immunohistochemical staining of human kidney using Anti-PLCE1 antibody HPA015597. |
|
|
HPA015597-100ul |
|
|
HPA015597-100ul |
|
|
HPA015597-100ul |
Produktgarantie und fachkundiger Support
