Anti-PLCE1

Catalog Number: ATA-HPA015597
Article Name: Anti-PLCE1
Biozol Catalog Number: ATA-HPA015597
Supplier Catalog Number: HPA015597
Alternative Catalog Number: ATA-HPA015597-100,ATA-HPA015597-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1516, NPHS3, PLCE
phospholipase C, epsilon 1
Anti-PLCE1
Clonality: Polyclonal
Concentration: 0.4 mg/ml
Isotype: IgG
NCBI: 51196
UniProt: Q9P212
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PLCE1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200
Immunohistochemical staining of human colon using Anti-PLCE1 antibody HPA015597.
Immunohistochemical staining of human liver using Anti-PLCE1 antibody HPA015597.
Immunohistochemical staining of human lymph node using Anti-PLCE1 antibody HPA015597.
Immunohistochemical staining of human kidney using Anti-PLCE1 antibody HPA015597.
HPA015597-100ul
HPA015597-100ul
HPA015597-100ul