Anti-GAP43

Artikelnummer: ATA-HPA015600
Artikelname: Anti-GAP43
Artikelnummer: ATA-HPA015600
Hersteller Artikelnummer: HPA015600
Alternativnummer: ATA-HPA015600-100,ATA-HPA015600-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B-50, PP46
growth associated protein 43
Anti-GAP43
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2596
UniProt: P17677
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GAP43
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GAP43 antibody. Corresponding GAP43 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA015600-100ul
HPA015600-100ul
HPA015600-100ul