Anti-GAP43

Catalog Number: ATA-HPA015600
Article Name: Anti-GAP43
Biozol Catalog Number: ATA-HPA015600
Supplier Catalog Number: HPA015600
Alternative Catalog Number: ATA-HPA015600-100,ATA-HPA015600-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: B-50, PP46
growth associated protein 43
Anti-GAP43
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 2596
UniProt: P17677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: GAP43
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane.
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GAP43 antibody. Corresponding GAP43 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA015600-100ul
HPA015600-100ul
HPA015600-100ul