Anti-SEMA4D
Artikelnummer:
ATA-HPA015662
- Bilder (7)
| Artikelname: | Anti-SEMA4D |
| Artikelnummer: | ATA-HPA015662 |
| Hersteller Artikelnummer: | HPA015662 |
| Alternativnummer: | ATA-HPA015662-100,ATA-HPA015662-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C9orf164, CD100, coll-4, FLJ39737, SEMAJ |
| sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
| Anti-SEMA4D |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10507 |
| UniProt: | Q92854 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEMA4D |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells. |
|
|
Western blot analysis in human cell line HDLM-2. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SEMA4D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416686). |
|
|
HPA015662-100ul |
|
|
|
|
|
HPA015662-100ul |
|
|
HPA015662-100ul |
Produktgarantie und fachkundiger Support
