Anti-SEMA4D

Catalog Number: ATA-HPA015662
Article Name: Anti-SEMA4D
Biozol Catalog Number: ATA-HPA015662
Supplier Catalog Number: HPA015662
Alternative Catalog Number: ATA-HPA015662-100,ATA-HPA015662-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C9orf164, CD100, coll-4, FLJ39737, SEMAJ
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
Anti-SEMA4D
Clonality: Polyclonal
Concentration: 0.1 mg/ml
Isotype: IgG
NCBI: 10507
UniProt: Q92854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: SEMA4D
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human lymph node shows cytoplasmic positivity in germinal center cells and non-germinal center cells.
Western blot analysis in human cell line HDLM-2.
Western blot analysis in control (vector only transfected HEK293T lysate) and SEMA4D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416686).
HPA015662-100ul
HPA015662-100ul
HPA015662-100ul