Anti-CD163L1
Artikelnummer:
ATA-HPA015663
- Bilder (8)
| Artikelname: | Anti-CD163L1 |
| Artikelnummer: | ATA-HPA015663 |
| Hersteller Artikelnummer: | HPA015663 |
| Alternativnummer: | ATA-HPA015663-100,ATA-HPA015663-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD163B, M160 |
| CD163 molecule-like 1 |
| Anti-CD163L1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 283316 |
| UniProt: | Q9NR16 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD163L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA015663 antibody. Corresponding CD163L1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA015663-100ul |
|
|
|
|
|
HPA015663-100ul |
|
|
HPA015663-100ul |
Produktgarantie und fachkundiger Support
