Anti-CD163L1
Catalog Number:
ATA-HPA015663
- Images (8)
| Article Name: | Anti-CD163L1 |
| Biozol Catalog Number: | ATA-HPA015663 |
| Supplier Catalog Number: | HPA015663 |
| Alternative Catalog Number: | ATA-HPA015663-100,ATA-HPA015663-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD163B, M160 |
| CD163 molecule-like 1 |
| Anti-CD163L1 |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 283316 |
| UniProt: | Q9NR16 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CD163L1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA015663 antibody. Corresponding CD163L1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non - germinal center cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA015663-100ul |
|
|
|
|
|
HPA015663-100ul |
|
|
HPA015663-100ul |
Product Guarantee and Expert Support
