Anti-HSPB8 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA015876
Artikelname: Anti-HSPB8 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA015876
Hersteller Artikelnummer: HPA015876
Alternativnummer: ATA-HPA015876-100,ATA-HPA015876-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: E2IG1, H11, HSP22, HspB8
heat shock 22kDa protein 8
Anti-HSPB8
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 26353
UniProt: Q9UJY1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HSPB8
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-HSPB8 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in control (vector only transfected HEK293T lysate) and HSPB8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415329).
HPA015876
HPA015876
HPA015876